Anti-CREB5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A90589-100
Artikelname: Anti-CREB5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A90589-100
Hersteller Artikelnummer: A90589-100
Alternativnummer: ABC-A90589-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 210-330 of human CREB5 (NP_878902.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CREB5.
Klonalität: Polyclonal
Molekulargewicht: 57 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: HPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTG
Target-Kategorie: CREB5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:5,000