Anti-SPPL2a Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A90593-50
Artikelname: Anti-SPPL2a Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A90593-50
Hersteller Artikelnummer: A90593-50
Alternativnummer: ABC-A90593-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 421-520 of human SPPL2A (NP_116191.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SPPL2a.
Klonalität: Polyclonal
Molekulargewicht: 57 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: AYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ
Target-Kategorie: SPPL2a
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:200-1:2,000, IHC: 1:50-1:200