Anti-CES2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A90596-50
Artikelname: Anti-CES2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A90596-50
Hersteller Artikelnummer: A90596-50
Alternativnummer: ABC-A90596-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 310-410 of human CES2 (NP_003860.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CES2.
Klonalität: Polyclonal
Molekulargewicht: 57 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: IPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEM
Target-Kategorie: CES2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000