Anti-EBF3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A90600-50
Artikelname: Anti-EBF3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A90600-50
Hersteller Artikelnummer: A90600-50
Alternativnummer: ABC-A90600-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EBF3 (NP_001005463.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to EBF3.
Klonalität: Polyclonal
Molekulargewicht: 60 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: AEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTSMNGYGSGAMASLGVPGSPGF
Target-Kategorie: EBF3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000