Anti-CYP7B1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A90601-50
Artikelname: Anti-CYP7B1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A90601-50
Hersteller Artikelnummer: A90601-50
Alternativnummer: ABC-A90601-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CYP7B1 (NP_004811.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CYP7B1.
Klonalität: Polyclonal
Molekulargewicht: 55 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: VIVCDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHHLGFLWASVANTIPT
Target-Kategorie: CYP7B1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200