Anti-K80 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9668-100
Artikelname: Anti-K80 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9668-100
Hersteller Artikelnummer: A9668-100
Alternativnummer: ABC-A9668-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 242-452 of human KRT80 (NP_872313.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to K80.
Klonalität: Polyclonal
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: SRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEAALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAASRSGLSKAPSRKKKGSKGPVIKITEMSEKYFSQESEVSE
Target-Kategorie: K80
Antibody Type: Primary Antibody
Application Verdünnung: ICC/IF: 1:50-1:200