Anti-CXCR5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9692-100
Artikelname: Anti-CXCR5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9692-100
Hersteller Artikelnummer: A9692-100
Alternativnummer: ABC-A9692-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human CXCR5 (NP_001707.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CXCR5.
Klonalität: Polyclonal
Molekulargewicht: 45 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: LPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF
Target-Kategorie: CXCR5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000