Anti-CD63 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9694-100
Artikelname: Anti-CD63 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9694-100
Hersteller Artikelnummer: A9694-100
Alternativnummer: ABC-A9694-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 103-203 of human CD63 (NP_001771.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CD63.
Klonalität: Polyclonal
Molekulargewicht: 30 - 65 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Target-Kategorie: CD63
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:50-1:200