Anti-REG1A Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9700-100
Artikelname: Anti-REG1A Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9700-100
Hersteller Artikelnummer: A9700-100
Alternativnummer: ABC-A9700-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human REG1A (NP_002900.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to REG1A.
Klonalität: Polyclonal
Molekulargewicht: 25kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Sequenz: FNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWK
Target-Kategorie: REG1A
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2000