Anti-S100A12 / CGRP Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9701-100
Artikelname: Anti-S100A12 / CGRP Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9701-100
Hersteller Artikelnummer: A9701-100
Alternativnummer: ABC-A9701-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100A12 (NP_005612.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to S100A12 / CGRP.
Klonalität: Polyclonal
Molekulargewicht: 11 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Target-Kategorie: S100A12 / CGRP
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:100-1:500, ICC/IF: 1:50-1:200