Anti-KTN1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9762-100
Artikelname: Anti-KTN1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9762-100
Hersteller Artikelnummer: A9762-100
Alternativnummer: ABC-A9762-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KTN1 (NP_001072989.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to KTN1.
Klonalität: Polyclonal
Molekulargewicht: 166kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Sequenz: MEFYESAYFIVLIPSIVITVIFLFFWLFMKETLYDEVLAKQKREQKLIPTKTDKKKAEKKKNKKKEIQNGNLHESDSESVPRDFKLSDALAVEDDQVAPV
Target-Kategorie: KTN1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2000, IHC: 1:50-1:200