Anti-TDRD3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9781-50
Artikelname: Anti-TDRD3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9781-50
Hersteller Artikelnummer: A9781-50
Alternativnummer: ABC-A9781-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human TDRD3 (NP_110421.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TDRD3.
Klonalität: Polyclonal
Molekulargewicht: 73 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MLRLQMTDGHISCTAVEFSYMSKISLNTPPGTKVKLSGIVDIKNGFLLLNDSNTTVLGGEVEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHVQVDSRELDRRKTLQVTMPVKPTNDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNMNAAGNRNREVLQKEKSTKSEGKHEGVYRELVDEKALKHITEMGFSKEASRQALMDNG
Target-Kategorie: TDRD3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000