Anti-SLM-1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9793-50
Artikelname: Anti-SLM-1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9793-50
Hersteller Artikelnummer: A9793-50
Alternativnummer: ABC-A9793-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human KHDRBS2 (NP_689901.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SLM-1.
Klonalität: Polyclonal
Molekulargewicht: 39 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: TAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEYDDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYDSYAPEEWATTRSSLKAPPQRSARGGYREHPYGRY
Target-Kategorie: SLM-1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:100-1:200