Anti-FGF 23 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9796-50
Artikelname: Anti-FGF 23 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9796-50
Hersteller Artikelnummer: A9796-50
Alternativnummer: ABC-A9796-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-251 of human FGF23 (NP_065689.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to FGF 23.
Klonalität: Polyclonal
Molekulargewicht: 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Target-Kategorie: FGF 23
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, ICC/IF: 1:50-1:200