Anti-DcR2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9798-50
Artikelname: Anti-DcR2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9798-50
Hersteller Artikelnummer: A9798-50
Alternativnummer: ABC-A9798-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 257-386 of human TNFRSF10D (NP_003831.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to DcR2.
Klonalität: Polyclonal
Molekulargewicht: 47 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: VLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQELAELTGVTVELPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKETIQDQLVGSEKLFYEEDEAGSATSCL
Target-Kategorie: DcR2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:50-1:200