Anti-ADAM5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9813-50
Artikelname: Anti-ADAM5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9813-50
Hersteller Artikelnummer: A9813-50
Alternativnummer: ABC-A9813-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human ADAM5 (Q6NVV9).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ADAM5.
Klonalität: Polyclonal
Molekulargewicht: 50 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: NCGTAHCLFQHILCGKLVCTWEHRDLISRPNLSVIYAHVRDQTCVSTYLPRRTPPPVNSPISITSYYSAEDRDETFVQDGSMCGPDMYCFEMHCKHVRFLM
Target-Kategorie: ADAM5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500