Anti-CXCL11 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9814-100
Artikelname: Anti-CXCL11 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9814-100
Hersteller Artikelnummer: A9814-100
Alternativnummer: ABC-A9814-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human CXCL11 (NP_005400.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CXCL11.
Klonalität: Polyclonal
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Target-Kategorie: CXCL11
Antibody Type: Primary Antibody
Application Verdünnung: IHC: 1:100-1:200