Anti-IL2 Receptor beta / p75 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9815-100
Artikelname: Anti-IL2 Receptor beta / p75 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9815-100
Hersteller Artikelnummer: A9815-100
Alternativnummer: ABC-A9815-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 316-431 of human IL2RB (NP_000869.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to IL2 Receptor beta / p75.
Klonalität: Polyclonal
Molekulargewicht: 75 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: GGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCTFPSRDDLLLFS
Target-Kategorie: IL2 Receptor beta / p75
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500