Anti-Arg2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9841-50
Artikelname: Anti-Arg2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9841-50
Hersteller Artikelnummer: A9841-50
Alternativnummer: ABC-A9841-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 270-354 of human Arginase 2 (ARG2) (NP_001163.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Arg2.
Klonalität: Polyclonal
Molekulargewicht: 39 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: GLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI
Target-Kategorie: Arg2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000