Anti-Lysosomal acid lipase / LAL Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9847-100
Artikelname: Anti-Lysosomal acid lipase / LAL Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9847-100
Hersteller Artikelnummer: A9847-100
Alternativnummer: ABC-A9847-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-399 of human LIPA (NP_001121077.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Lysosomal acid lipase / LAL.
Klonalität: Polyclonal
Molekulargewicht: 40 - 45 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: DAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNL
Target-Kategorie: Lysosomal acid lipase / LAL
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200