Anti-TCN1 Antibody - Identical to Abcam (ab202121), Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9856-100
Artikelname: Anti-TCN1 Antibody - Identical to Abcam (ab202121), Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9856-100
Hersteller Artikelnummer: A9856-100
Alternativnummer: ABC-A9856-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-280 of human TCN1 (NP_001053.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TCN1.
Klonalität: Polyclonal
Molekulargewicht: 48 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: EICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEIS
Target-Kategorie: TCN1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000