Anti-RAMP1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9872-50
Artikelname: Anti-RAMP1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9872-50
Hersteller Artikelnummer: A9872-50
Alternativnummer: ABC-A9872-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-148 of human RAMP1 (NP_005846.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to RAMP1.
Klonalität: Polyclonal
Molekulargewicht: 17 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: AVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV
Target-Kategorie: RAMP1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, ICC/IF: 1:50-1:200