Anti-Ahsp Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9881-100
Artikelname: Anti-Ahsp Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9881-100
Hersteller Artikelnummer: A9881-100
Alternativnummer: ABC-A9881-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human AHSP (NP_057717.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Ahsp.
Klonalität: Polyclonal
Molekulargewicht: 12 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
Target-Kategorie: Ahsp
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000