Anti-POLR3K Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9882-100
Artikelname: Anti-POLR3K Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9882-100
Hersteller Artikelnummer: A9882-100
Alternativnummer: ABC-A9882-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human POLR3K (NP_057394.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to POLR3K.
Klonalität: Polyclonal
Molekulargewicht: 12kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Sequenz: MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Target-Kategorie: POLR3K
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2000