Anti-Caspase-4 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ABC-A9894-50
| Artikelname: |
Anti-Caspase-4 Antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ABC-A9894-50 |
| Hersteller Artikelnummer: |
A9894-50 |
| Alternativnummer: |
ABC-A9894-50 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of mouse Caspase-4 (NP_031635.2). |
| Konjugation: |
Unconjugated |
| Rabbit polyclonal antibody to Caspase-4. |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
43 kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Formulierung: |
Liquid |
| Sequenz: |
FLVLMSHGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQACRGGNSGEMWIRESSKPQLCRGVDLPRNMEADAVKLSHVEKDFIAFY |
| Target-Kategorie: |
Caspase-4 |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:100-1:500 |
