Anti-Anillin Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9902-100
Artikelname: Anti-Anillin Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9902-100
Hersteller Artikelnummer: A9902-100
Alternativnummer: ABC-A9902-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 845-1124 of human ANLN (NP_061155.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Anillin.
Klonalität: Polyclonal
Molekulargewicht: 120 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: ATPLASTSNSLNGDALTFTTTFTLQDVSNDFEINIEVYSLVQKKDPSGLDKKKKTSKSKAITPKRLLTSITTKSNIHSSVMASPGGLSAVRTSNFALVGSYTLSLSSVGNTKFVLDKVPFLSSLEGHIYLKIKCQVNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDEKRKNPIGRINLANCTSRQIEPANREFCARRNTFELITVRPQREDDRETLVSQCRDTLCVTKNWLSADTKEERDLW
Target-Kategorie: Anillin
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000