Anti-ASAH1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9903-100
Artikelname: Anti-ASAH1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9903-100
Hersteller Artikelnummer: A9903-100
Alternativnummer: ABC-A9903-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 140-389 of human ASAH1 (NP_001120977.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ASAH1.
Klonalität: Polyclonal
Molekulargewicht: 50 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: IVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDVMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW
Target-Kategorie: ASAH1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000