Anti-INTS11 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9918-50
Artikelname: Anti-INTS11 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9918-50
Hersteller Artikelnummer: A9918-50
Alternativnummer: ABC-A9918-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 331-600 of human CPSF3L (NP_060341.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to INTS11.
Klonalität: Polyclonal
Molekulargewicht: 68 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: GQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELG
Target-Kategorie: INTS11
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:10-1:100, IP: 1:100-1:500