Anti-GALNT3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9929-100
Artikelname: Anti-GALNT3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9929-100
Hersteller Artikelnummer: A9929-100
Alternativnummer: ABC-A9929-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human GALNT3 (NP_004473.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to GALNT3.
Klonalität: Polyclonal
Molekulargewicht: 73kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Sequenz: MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKE
Target-Kategorie: GALNT3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2000