Anti-GLP2R Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9933-100
Artikelname: Anti-GLP2R Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9933-100
Hersteller Artikelnummer: A9933-100
Alternativnummer: ABC-A9933-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 460-553 of human GLP2R (NP_004237.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to GLP2R.
Klonalität: Polyclonal
Molekulargewicht: 63 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: SGCRACVLGKDFRFLGKCPKKLSEGDGAEKLRKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTMANTMEEILEESEI
Target-Kategorie: GLP2R
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200