Anti-GLUD2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9935-100
Artikelname: Anti-GLUD2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9935-100
Hersteller Artikelnummer: A9935-100
Alternativnummer: ABC-A9935-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 319-558 of human GLUD2 (NP_036216.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to GLUD2.
Klonalität: Polyclonal
Molekulargewicht: 52 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: YLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT
Target-Kategorie: GLUD2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200