Anti-HAS3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9941-50
Artikelname: Anti-HAS3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9941-50
Hersteller Artikelnummer: A9941-50
Alternativnummer: ABC-A9941-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 67-281 of human HAS3 (NP_619515.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to HAS3.
Klonalität: Polyclonal
Molekulargewicht: 73 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: HRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ
Target-Kategorie: HAS3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000