Anti-IL-9R Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9948-50
Artikelname: Anti-IL-9R Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9948-50
Hersteller Artikelnummer: A9948-50
Alternativnummer: ABC-A9948-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IL9R (XP_011529456.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to IL-9R.
Klonalität: Polyclonal
Molekulargewicht: 57 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: PELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPA
Target-Kategorie: IL-9R
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:100-1:200