Anti-HSPA2 Antibody [ARC1415], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A9952-100
Artikelname: Anti-HSPA2 Antibody [ARC1415], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A9952-100
Hersteller Artikelnummer: A9952-100
Alternativnummer: ABC-A9952-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 488-637 of human HSPA2 (P54652).
Konjugation: Unconjugated
Rabbit monoclonal [ARC1415] antibody to HSPA2.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1415]
Molekulargewicht: 70 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: ILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEE
Target-Kategorie: HSPA2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200