Anti-MYLK3 / MLCK Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9958-100
Artikelname: Anti-MYLK3 / MLCK Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9958-100
Hersteller Artikelnummer: A9958-100
Alternativnummer: ABC-A9958-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human MYLK3 (NP_872299.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to MYLK3 / MLCK.
Klonalität: Polyclonal
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MQQDAAQHGARLEALFRMVAAVDRAIALVGATFQKSKVADFLMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGT
Target-Kategorie: MYLK3 / MLCK
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:100