Anti-NALP12 / NLRP12 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ABC-A9961-100
| Artikelname: |
Anti-NALP12 / NLRP12 Antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ABC-A9961-100 |
| Hersteller Artikelnummer: |
A9961-100 |
| Alternativnummer: |
ABC-A9961-100 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 862-1062 of human NLRP12 (NP_001264055.1). |
| Konjugation: |
Unconjugated |
| Rabbit polyclonal antibody to NALP12 / NLRP12. |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
120 kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Formulierung: |
Liquid |
| Sequenz: |
LWLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRHPTCKLQTLRLGICRLGSAACEGLSVVLQANHNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKLWLDSCGLTAKACENLYFTLGINQTLTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVLWLFGMDLNKMTHSRLAALRVTKPYLDIGC |
| Target-Kategorie: |
NALP12 / NLRP12 |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:500-1:2,000 |
