Anti-OSMR Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9965-100
Artikelname: Anti-OSMR Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9965-100
Hersteller Artikelnummer: A9965-100
Alternativnummer: ABC-A9965-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-330 of human OSMR (NP_003990.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to OSMR.
Klonalität: Polyclonal
Molekulargewicht: 111 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: LPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSG
Target-Kategorie: OSMR
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000