Anti-PDXK.1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9968-50
Artikelname: Anti-PDXK.1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9968-50
Hersteller Artikelnummer: A9968-50
Alternativnummer: ABC-A9968-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-312 of human PDXK (NP_003672.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PDXK.1.
Klonalität: Polyclonal
Molekulargewicht: 35 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKV
Target-Kategorie: PDXK.1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:10-1:100