Anti-PLA2G2D Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9969-50
Artikelname: Anti-PLA2G2D Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9969-50
Hersteller Artikelnummer: A9969-50
Alternativnummer: ABC-A9969-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-145 of human PLA2G2D (NP_036532.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PLA2G2D.
Klonalität: Polyclonal
Molekulargewicht: 20kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Sequenz: GILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC
Target-Kategorie: PLA2G2D
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2000, IHC: 1:50-1:200, IF: 1:10-1:100