Anti-Scramblase 1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9970-100
Artikelname: Anti-Scramblase 1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9970-100
Hersteller Artikelnummer: A9970-100
Alternativnummer: ABC-A9970-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-318 of human Phospholipid Scramblase 1 (Phospholipid Scramblase 1 (PLSCR1)) (NP_066928.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Scramblase 1.
Klonalität: Polyclonal
Molekulargewicht: 35 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQC
Target-Kategorie: Scramblase 1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000