Anti-Metnase Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9984-100
Artikelname: Anti-Metnase Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9984-100
Hersteller Artikelnummer: A9984-100
Alternativnummer: ABC-A9984-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human SETMAR (NP_006506.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Metnase.
Klonalität: Polyclonal
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: KPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSE
Target-Kategorie: Metnase
Antibody Type: Primary Antibody
Application Verdünnung: IHC: 1:50-1:200