Anti-TANK / TRAF2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9990-100
Artikelname: Anti-TANK / TRAF2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9990-100
Hersteller Artikelnummer: A9990-100
Alternativnummer: ABC-A9990-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human TANK (NP_597841.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TANK / TRAF2.
Klonalität: Polyclonal
Molekulargewicht: 47 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI
Target-Kategorie: TANK / TRAF2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000