Anti-TREX1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9994-100
Artikelname: Anti-TREX1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9994-100
Hersteller Artikelnummer: A9994-100
Alternativnummer: ABC-A9994-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 172-314 of human TREX1 (NP_338599.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TREX1.
Klonalität: Polyclonal
Molekulargewicht: 35 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: GPRKSYSLGSIYTRLYGQSPPDSHTAEGDVLALLSICQWRPQALLRWVDAHARPFGTIRPMYGVTASARTKPRPSAVTTTAHLATTRNTSPSLGESRGTKDLPPVKDPGALSREGLLAPLGLLAILTLAVATLYGLSLATPGE
Target-Kategorie: TREX1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200