Anti-UQCRFS1 / RISP Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9995-100
Artikelname: Anti-UQCRFS1 / RISP Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9995-100
Hersteller Artikelnummer: A9995-100
Alternativnummer: ABC-A9995-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 141-274 of human UQCRFS1 (NP_005994.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to UQCRFS1 / RISP.
Klonalität: Polyclonal
Molekulargewicht: 23 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: SASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG
Target-Kategorie: UQCRFS1 / RISP
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200