Anti-YB1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9997-100
Artikelname: Anti-YB1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9997-100
Hersteller Artikelnummer: A9997-100
Alternativnummer: ABC-A9997-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human YB-1/YBX1 (NP_004550.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to YB1.
Klonalität: Polyclonal
Molekulargewicht: 50 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVI
Target-Kategorie: YB1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:20-1:50