PD-1 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Programmed Cell Death Protein -1 (PD-1, also known as CD279). Sequence data: hPD-1 (accession number NP_005009) MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFS
Application Verdünnung:
Application: Screen for antibodies of human PD-1 through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten