PD-L1 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Programmed Death- Ligand 1 (PD-L1, also known as CD274 and B7-H1). Sequence data: hPD-L1 (accession number NP_054862) MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDL
Application Verdünnung:
Application:. Screen for antibodies of human PD-L1 through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten