ICOSL Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human ICOS Ligand (ICOSL, also known as B7-H2, B7RP-1, and CD275). Sequence data: hICOSL (accession number NP_056074) MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQT
Application Verdünnung:
Application:. Screen for antibodies of human ICOSL through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
