hB7-H4 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human B7-H4, also known as VTCN1. Sequence data: hB7-H4 (accession number NP_078902) MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEP DIKLSDIVIQWLKEGVLGLVHEFKEGK
Application Verdünnung:
Application:. Screen for antibodies of human B7-H4 through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten