Langerin Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Langerin, also known as CD207. Sequence data: hLangerin (accession number NP_056532) MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQ AVLYPRFMGTISDVKTNVQ
Application Verdünnung:
Application:. Screen for antibodies of human Langerin through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten