Langerin Stable Cell Line

Produktübersicht

• Artikelname: Langerin Stable Cell Line
• Artikelnummer: ABI-14-509ACL
• Hersteller Artikelnummer: 14-509ACL
• Alternativnummer: ABI-14-509ACL-1VIAL
• Hersteller: Abeomics
• Kategorie: Zellen/Zellkultur
• Applikation: FA

Produktbeschreibung

Langerin Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Langerin, also known as CD207. Sequence data: hLangerin (accession number NP_056532) MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQ AVLYPRFMGTISDVKTNVQ

Anwendungsbeschreibung

• Application Verdünnung: Application:. Screen for antibodies of human Langerin through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS